PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.11243s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 171aa    MW: 20081.3 Da    PI: 10.1212
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.11243s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.31.9e-241668355
               G2-like  3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                           +rWt +L   F ++ve LGG+ kAtPk il++m+v  Lt++hvkSHLQ+YR 
  Araha.11243s0002.1.p 16 PMRWTDDLDLLFTQVVELLGGERKATPKPILKCMDVRNLTISHVKSHLQMYRK 68
                          69**************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-231170IPR009057Homeodomain-like
PROSITE profilePS512949.0211171IPR017930Myb domain
SuperFamilySSF466895.91E-141372IPR009057Homeodomain-like
PfamPF002499.4E-81767IPR001005SANT/Myb domain
TIGRFAMsTIGR015578.4E-221770IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MKKTIVRCYI RSKVPPMRWT DDLDLLFTQV VELLGGERKA TPKPILKCMD VRNLTISHVK  60
SHLQMYRKKK KEESIKEKRL MLEMNRRQSQ QYLQIYERAR DATQFIQNQQ RPQLDIIEKI  120
TPVLESSNKF LYQFSRERLN ENKNNDVVVA GGSAIGEEEL SLELTLGHKY *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16671RKKKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002874800.13e-99hypothetical protein ARALYDRAFT_352378
TrEMBLD7M1R34e-99D7M1R3_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_60029711e-98(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04580.12e-63G2-like family protein